PTGR2 Antikörper (Middle Region)
-
- Target Alle PTGR2 Antikörper anzeigen
- PTGR2 (Prostaglandin Reductase 2 (PTGR2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PTGR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZADH1 antibody was raised against the middle region of Zadh1
- Aufreinigung
- Affinity purified
- Immunogen
- ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT
- Top Product
- Discover our top product PTGR2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZADH1 Blocking Peptide, catalog no. 33R-4040, is also available for use as a blocking control in assays to test for specificity of this ZADH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZADH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTGR2 (Prostaglandin Reductase 2 (PTGR2))
- Andere Bezeichnung
- ZADH1 (PTGR2 Produkte)
- Synonyme
- ZADH1 antikoerper, MGC146252 antikoerper, PGR2 antikoerper, 1810016I24Rik antikoerper, 9130222H03Rik antikoerper, 9630002F03Rik antikoerper, AI838763 antikoerper, B830026H24Rik antikoerper, PGR-2 antikoerper, PRG-2 antikoerper, Zadh1 antikoerper, prostaglandin reductase 2 antikoerper, prostaglandin reductase 2 S homeolog antikoerper, PTGR2 antikoerper, ptgr2 antikoerper, ptgr2.S antikoerper, Ptgr2 antikoerper
- Hintergrund
- ZADH1 is an enzyme involved in the metabolism of prostaglandins. ZADH1 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. ZADH1 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.
- Molekulargewicht
- 38 kDa (MW of target protein)
-