BBS5 Antikörper (Middle Region)

Produktnummer ABIN631562

Produktdetails anti-BBS5 Antikörper

Target: BBS5 (Bardet-Biedl Syndrome 5 (BBS5))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BBS5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BBS5 antibody was raised against the middle region of BBS5

Aufreinigung: Affinity purified

Immunogen: BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BBS5 Blocking Peptide, catalog no. 33R-9497, is also available for use as a blocking control in assays to test for specificity of this BBS5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BBS5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BBS5

Target: BBS5 (Bardet-Biedl Syndrome 5 (BBS5))

Andere Bezeichnung: BBS5 (BBS5 Produkte)

Synonyme: zgc:56578 antikoerper, 1700049I01Rik antikoerper, 2700023J09Rik antikoerper, Bardet-Biedl syndrome 5 antikoerper, Bardet-Biedl syndrome 5 (human) antikoerper, bbs5 antikoerper, BBS5 antikoerper, Bbs5 antikoerper

Hintergrund: BBS5 is a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Hedgehog Signalweg