POLR2K Antikörper (Middle Region)
-
- Target Alle POLR2K Antikörper anzeigen
- POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POLR2K Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- POLR2 K antibody was raised against the middle region of POLR2
- Aufreinigung
- Affinity purified
- Immunogen
- POLR2 K antibody was raised using the middle region of POLR2 corresponding to a region with amino acids DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR
- Top Product
- Discover our top product POLR2K Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POLR2K Blocking Peptide, catalog no. 33R-2205, is also available for use as a blocking control in assays to test for specificity of this POLR2K antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))
- Andere Bezeichnung
- POLR2K (POLR2K Produkte)
- Synonyme
- ABC10-alpha antikoerper, RPABC4 antikoerper, RPB10alpha antikoerper, RPB12 antikoerper, RPB7.0 antikoerper, hRPB7.0 antikoerper, hsRPB10a antikoerper, MafY antikoerper, Mt1a antikoerper, rpb12 antikoerper, rpabc4 antikoerper, rpb7.0 antikoerper, hrpb7.0 antikoerper, hsrpb10a antikoerper, rpb10alpha antikoerper, abc10-alpha antikoerper, POLR2K antikoerper, polr2ka antikoerper, polr2kb antikoerper, zgc:171795 antikoerper, RNA polymerase II subunit K antikoerper, polymerase (RNA) II (DNA directed) polypeptide K antikoerper, polymerase (RNA) II subunit K antikoerper, polymerase (RNA) II subunit K L homeolog antikoerper, polymerase (RNA) II subunit K S homeolog antikoerper, POLR2K antikoerper, Polr2k antikoerper, polr2k antikoerper, polr2k.L antikoerper, polr2k.S antikoerper
- Hintergrund
- POLR2K is one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases.
- Molekulargewicht
- 7 kDa (MW of target protein)
- Pathways
- Regulatorische RNA Pathways
-