NEXN Antikörper

Produktnummer ABIN631522

Produktdetails anti-NEXN Antikörper

Target: NEXN (Nexilin (NEXN))

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEXN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Nexilin antibody was raised using a synthetic peptide corresponding to a region with amino acids EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Nexilin Blocking Peptide, catalog no. 33R-2372, is also available for use as a blocking control in assays to test for specificity of this Nexilin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEXN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEXN

Target: NEXN (Nexilin (NEXN))

Andere Bezeichnung: Nexilin (NEXN Produkte)

Synonyme: 1110046H09Rik antikoerper, AA553326 antikoerper, NELIN antikoerper, CMH20 antikoerper, nexilin antikoerper, nexilin F-actin binding protein antikoerper, nexilin F-actin binding protein S homeolog antikoerper, nexilin (F actin binding protein) antikoerper, LOC100422793 antikoerper, nexn antikoerper, Nexn antikoerper, nexn.S antikoerper, NEXN antikoerper

Hintergrund: NEXN is involved in regulating cell migration through association with the actin cytoskeleton.

Molekulargewicht: 81 kDa (MW of target protein)