ACD Antikörper

Produktnummer ABIN631477

Produktdetails anti-ACD Antikörper

Target: ACD (Adrenocortical Dysplasia Homolog (ACD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACD Blocking Peptide, catalog no. 33R-4573, is also available for use as a blocking control in assays to test for specificity of this ACD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACD

Target: ACD (Adrenocortical Dysplasia Homolog (ACD))

Andere Bezeichnung: ACD (ACD Produkte)

Synonyme: PIP1 antikoerper, PTOP antikoerper, TINT1 antikoerper, TPP1 antikoerper, ACD antikoerper, ACD, shelterin complex subunit and telomerase recruitment factor antikoerper, adrenocortical dysplasia antikoerper, ACD antikoerper, Acd antikoerper

Hintergrund: ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Telomere Maintenance