ACD Antikörper
-
- Target Alle ACD Antikörper anzeigen
- ACD (Adrenocortical Dysplasia Homolog (ACD))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ
- Top Product
- Discover our top product ACD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACD Blocking Peptide, catalog no. 33R-4573, is also available for use as a blocking control in assays to test for specificity of this ACD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACD (Adrenocortical Dysplasia Homolog (ACD))
- Andere Bezeichnung
- ACD (ACD Produkte)
- Synonyme
- PIP1 antikoerper, PTOP antikoerper, TINT1 antikoerper, TPP1 antikoerper, ACD antikoerper, ACD, shelterin complex subunit and telomerase recruitment factor antikoerper, adrenocortical dysplasia antikoerper, ACD antikoerper, Acd antikoerper
- Hintergrund
- ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- Telomere Maintenance
-