Golgin A7 Antikörper (Middle Region)
-
- Target Alle Golgin A7 (GOLGA7) Antikörper anzeigen
- Golgin A7 (GOLGA7)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Maus, Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Golgin A7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GOLGA7 antibody was raised against the middle region of GOLGA7
- Aufreinigung
- Affinity purified
- Immunogen
- GOLGA7 antibody was raised using the middle region of GOLGA7 corresponding to a region with amino acids ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL
- Top Product
- Discover our top product GOLGA7 Primärantikörper
-
anti-Golgin A7 (GOLGA7) (AA 1-137) antibody
GOLGA7 Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 2H8 unconjugated
anti-Golgin A7 (GOLGA7) antibodyGOLGA7 Reaktivität: Maus, Human, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (AA 1-134) antibodyGOLGA7 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (N-Term) antibodyGOLGA7 Reaktivität: Maus, Human, Rind (Kuh), Kaninchen, Hund, Pferd, Zebrafisch (Danio rerio), Schwein, Affe, Fledermaus, Xenopus laevis, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (AA 71-120) antibodyGOLGA7 Reaktivität: Maus, Human, Ratte, Rind (Kuh), Kaninchen, Hund, Pferd, Meerschweinchen, Schwein, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (N-Term) antibodyGOLGA7 Reaktivität: Maus, Human, Ratte, Rind (Kuh), Kaninchen, Hund, Pferd, Zebrafisch (Danio rerio), Meerschweinchen, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (Middle Region) antibodyGOLGA7 Reaktivität: Maus, Human, Ratte, Rind (Kuh), Kaninchen, Hund, Pferd, Zebrafisch (Danio rerio), Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GOLGA7 Blocking Peptide, catalog no. 33R-1074, is also available for use as a blocking control in assays to test for specificity of this GOLGA7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGA7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Golgin A7 (GOLGA7)
- Andere Bezeichnung
- GOLGA7 (GOLGA7 Produkte)
- Synonyme
- gcp16 antikoerper, golga7a antikoerper, hspc041 antikoerper, MGC79092 antikoerper, golga3ap1 antikoerper, AB041568 antikoerper, C130038N16Rik antikoerper, GCP16 antikoerper, GOLGA3AP1 antikoerper, HSPC041 antikoerper, R75586 antikoerper, GOLGA7A antikoerper, golgin A7 L homeolog antikoerper, golgin A7 antikoerper, golgi autoantigen, golgin subfamily a, 7 antikoerper, golga7.L antikoerper, golga7 antikoerper, Golga7 antikoerper, GOLGA7 antikoerper
- Hintergrund
- GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
- Molekulargewicht
- 16 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-
