SCGN Antikörper (Middle Region)
-
- Target Alle SCGN Antikörper anzeigen
- SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SCGN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SCGN antibody was raised against the middle region of SCGN
- Aufreinigung
- Affinity purified
- Immunogen
- SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids LQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDM
- Top Product
- Discover our top product SCGN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SCGN Blocking Peptide, catalog no. 33R-5304, is also available for use as a blocking control in assays to test for specificity of this SCGN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCGN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))
- Andere Bezeichnung
- SCGN (SCGN Produkte)
- Synonyme
- SCGN antikoerper, MGC146683 antikoerper, CALBL antikoerper, DJ501N12.8 antikoerper, SECRET antikoerper, SEGN antikoerper, setagin antikoerper, zgc:100843 antikoerper, secretagogin, EF-hand calcium binding protein antikoerper, Secretagogin antikoerper, secretagogin, EF-hand calcium binding protein L homeolog antikoerper, SCGN antikoerper, scgn antikoerper, segn antikoerper, scgn.L antikoerper, Scgn antikoerper
- Hintergrund
- SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.
- Molekulargewicht
- 32 kDa (MW of target protein)
-