GSTM2 Antikörper
-
- Target Alle GSTM2 Antikörper anzeigen
- GSTM2 (Glutathione S-Transferase mu 2 (Muscle) (GSTM2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GSTM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- GSTM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
- Top Product
- Discover our top product GSTM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GSTM2 Blocking Peptide, catalog no. 33R-9250, is also available for use as a blocking control in assays to test for specificity of this GSTM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTM2 (Glutathione S-Transferase mu 2 (Muscle) (GSTM2))
- Andere Bezeichnung
- GSTM2 (GSTM2 Produkte)
- Synonyme
- GSTA4 antikoerper, GST4 antikoerper, GSTM antikoerper, GSTM2-2 antikoerper, GTHMUS antikoerper, Gstb-2 antikoerper, Gstb2 antikoerper, GSTIV antikoerper, glutathione S-transferase mu 2 antikoerper, glutathione S-transferase mu 2 (muscle) antikoerper, glutathione S-transferase Mu 2 antikoerper, glutathione S-transferase, mu 2 antikoerper, glutathione S-transferase 2 antikoerper, Glutathione S-transferase 4 antikoerper, Gstm2 antikoerper, GSTM2 antikoerper, LOC100732167 antikoerper, gst2 antikoerper, gst-4 antikoerper
- Hintergrund
- GSTM2 is a glutathione S-transferase that belongs to the mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.
- Molekulargewicht
- 26 kDa (MW of target protein)
- Pathways
- Negative Regulation of Transporter Activity
-