Involucrin Antikörper (N-Term)

Produktnummer ABIN631419

Produktdetails anti-Involucrin Antikörper

Target: Involucrin (IVL)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Involucrin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Involucrin antibody was raised against the N terminal of IVL

Aufreinigung: Affinity purified

Immunogen: Involucrin antibody was raised using the N terminal of IVL corresponding to a region with amino acids AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Involucrin Blocking Peptide, catalog no. 33R-1140, is also available for use as a blocking control in assays to test for specificity of this Involucrin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IVL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Involucrin

Target: Involucrin (IVL)

Andere Bezeichnung: Involucrin (IVL Produkte)

Synonyme: INV antikoerper, NPH2 antikoerper, NPHP2 antikoerper, 1110019C06Rik antikoerper, IVL antikoerper, Nphp2 antikoerper, inv antikoerper, involucrin antikoerper, inversin antikoerper, IVL antikoerper, INVS antikoerper, Ivl antikoerper, Invs antikoerper

Hintergrund: Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase.Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase. This gene is mapped to 1q21, among calpactin I light chain, trichohyalin, profillaggrin, loricrin, and calcyclin.

Molekulargewicht: 68 kDa (MW of target protein)