CRYBB3 Antikörper (Middle Region)

Produktnummer ABIN631403

Produktdetails anti-CRYBB3 Antikörper

Target: CRYBB3 (CRYbB3) (Crystallin, beta B3 (CRYbB3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRYBB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Crystallin Beta B3 antibody was raised against the middle region of CRYBB3

Aufreinigung: Affinity purified

Immunogen: Crystallin Beta B3 antibody was raised using the middle region of CRYBB3 corresponding to a region with amino acids LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Crystallin Beta B3 Blocking Peptide, catalog no. 33R-5223, is also available for use as a blocking control in assays to test for specificity of this Crystallin Beta B3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYBB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRYBB3

Target: CRYBB3 (CRYbB3) (Crystallin, beta B3 (CRYbB3))

Andere Bezeichnung: Crystallin beta B3 (CRYbB3 Produkte)

Synonyme: MGC84109 antikoerper, CATCN2 antikoerper, CRYB3 antikoerper, CTRCT22 antikoerper, AI852419 antikoerper, crystallin beta B3 L homeolog antikoerper, crystallin beta B3 antikoerper, crystallin, beta B3 antikoerper, crybb3.L antikoerper, CRYBB3 antikoerper, crybb3 antikoerper, Crybb3 antikoerper

Hintergrund: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens.

Molekulargewicht: 24 kDa (MW of target protein)