RNF212 Antikörper (Middle Region)

Produktnummer ABIN631396

Produktdetails anti-RNF212 Antikörper

Target: RNF212 (Ring Finger Protein 212 (RNF212))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF212 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF212 antibody was raised against the middle region of RNF212

Aufreinigung: Affinity purified

Immunogen: RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF212 Blocking Peptide, catalog no. 33R-4823, is also available for use as a blocking control in assays to test for specificity of this RNF212 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF212 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF212

Target: RNF212 (Ring Finger Protein 212 (RNF212))

Andere Bezeichnung: RNF212 (RNF212 Produkte)

Synonyme: ZHP3 antikoerper, ring finger protein 212 antikoerper, RNF212 antikoerper

Hintergrund: RNF212 contains 1 RING-type zinc finger. The function of the RNF212 protein remains unknown.

Molekulargewicht: 26 kDa (MW of target protein)