CGR19 Antikörper (Middle Region)
-
- Target Alle CGR19 (CGRRF1) Antikörper anzeigen
- CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CGR19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CGRRF1 antibody was raised against the middle region of CGRRF1
- Aufreinigung
- Affinity purified
- Immunogen
- CGRRF1 antibody was raised using the middle region of CGRRF1 corresponding to a region with amino acids KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS
- Top Product
- Discover our top product CGRRF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CGRRF1 Blocking Peptide, catalog no. 33R-4453, is also available for use as a blocking control in assays to test for specificity of this CGRRF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CGRRF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))
- Andere Bezeichnung
- CGRRF1 (CGRRF1 Produkte)
- Synonyme
- MGC85426 antikoerper, CGRRF1 antikoerper, si:dkey-29m11.5 antikoerper, si:dkey-63j12.2 antikoerper, zgc:136229 antikoerper, CGR19 antikoerper, RNF197 antikoerper, 1110038G02Rik antikoerper, 1810009H17Rik antikoerper, Cgr19 antikoerper, cell growth regulator with ring finger domain 1 L homeolog antikoerper, cell growth regulator with ring finger domain 1 antikoerper, cgrrf1.L antikoerper, CGRRF1 antikoerper, cgrrf1 antikoerper, Cgrrf1 antikoerper
- Hintergrund
- CGRRF1 is able to inhibit growth in several cell lines.
- Molekulargewicht
- 38 kDa (MW of target protein)
-