CGR19 Antikörper (Middle Region)

Produktnummer ABIN631344

Produktdetails anti-CGR19 Antikörper

Target: CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CGR19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CGRRF1 antibody was raised against the middle region of CGRRF1

Aufreinigung: Affinity purified

Immunogen: CGRRF1 antibody was raised using the middle region of CGRRF1 corresponding to a region with amino acids KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CGRRF1 Blocking Peptide, catalog no. 33R-4453, is also available for use as a blocking control in assays to test for specificity of this CGRRF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CGRRF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CGR19

Target: CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))

Andere Bezeichnung: CGRRF1 (CGRRF1 Produkte)

Synonyme: MGC85426 antikoerper, CGRRF1 antikoerper, si:dkey-29m11.5 antikoerper, si:dkey-63j12.2 antikoerper, zgc:136229 antikoerper, CGR19 antikoerper, RNF197 antikoerper, 1110038G02Rik antikoerper, 1810009H17Rik antikoerper, Cgr19 antikoerper, cell growth regulator with ring finger domain 1 L homeolog antikoerper, cell growth regulator with ring finger domain 1 antikoerper, cgrrf1.L antikoerper, CGRRF1 antikoerper, cgrrf1 antikoerper, Cgrrf1 antikoerper

Hintergrund: CGRRF1 is able to inhibit growth in several cell lines.

Molekulargewicht: 38 kDa (MW of target protein)