RFFL Antikörper (Middle Region)
-
- Target Alle RFFL Antikörper anzeigen
- RFFL (Ring Finger and FYVE-Like Domain Containing 1 (RFFL))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RFFL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RFFL antibody was raised against the middle region of RFFL
- Aufreinigung
- Affinity purified
- Immunogen
- RFFL antibody was raised using the middle region of RFFL corresponding to a region with amino acids KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT
- Top Product
- Discover our top product RFFL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RFFL Blocking Peptide, catalog no. 33R-4301, is also available for use as a blocking control in assays to test for specificity of this RFFL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFFL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RFFL (Ring Finger and FYVE-Like Domain Containing 1 (RFFL))
- Andere Bezeichnung
- RFFL (RFFL Produkte)
- Synonyme
- MGC84042 antikoerper, RFFL antikoerper, Rffl antikoerper, 1700051E09Rik antikoerper, 4930516L10Rik antikoerper, BG080975 antikoerper, Carp2 antikoerper, CARP-2 antikoerper, CARP2 antikoerper, FRING antikoerper, RIFIFYLIN antikoerper, RNF189 antikoerper, RNF34L antikoerper, ring finger and FYVE like domain containing E3 ubiquitin protein ligase antikoerper, ring finger and FYVE-like domain containing E3 ubiquitin protein ligase L homeolog antikoerper, ring finger and FYVE-like domain containing 1 antikoerper, ring finger and FYVE like domain containing protein antikoerper, ring finger and FYVE-like domain containing E3 ubiquitin protein ligase antikoerper, RFFL antikoerper, rffl.L antikoerper, Rffl antikoerper
- Hintergrund
- RFFL has E3 ubiquitin protein ligase activity.RFFL regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. RFFL may bind phosphatidylinositol phosphates.
- Molekulargewicht
- 40 kDa (MW of target protein)
-