RNF125 Antikörper (Middle Region)

Produktnummer ABIN631338

Produktdetails anti-RNF125 Antikörper

Target: RNF125 (Ring Finger Protein 125 (RNF125))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF125 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF125 antibody was raised against the middle region of RNF125

Aufreinigung: Affinity purified

Immunogen: RNF125 antibody was raised using the middle region of RNF125 corresponding to a region with amino acids ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF125 Blocking Peptide, catalog no. 33R-2614, is also available for use as a blocking control in assays to test for specificity of this RNF125 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF125 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF125

Target: RNF125 (Ring Finger Protein 125 (RNF125))

Andere Bezeichnung: RNF125 (RNF125 Produkte)

Synonyme: 4930553F04Rik antikoerper, TRAC-1 antikoerper, TRAC1 antikoerper, ring finger protein 125 antikoerper, RNF125 antikoerper, Rnf125 antikoerper

Hintergrund: This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.

Molekulargewicht: 26 kDa (MW of target protein)