PIP4K2A Antikörper (N-Term)

Produktnummer ABIN631281

Produktdetails anti-PIP4K2A Antikörper

Target: PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIP4K2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIP4 K4 antibody was raised against the N terminal of PIP4 4

Aufreinigung: Affinity purified

Immunogen: PIP4 K4 antibody was raised using the N terminal of PIP4 4 corresponding to a region with amino acids IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIP4K2A Blocking Peptide, catalog no. 33R-3909, is also available for use as a blocking control in assays to test for specificity of this PIP4K2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIP4K2A

Target: PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))

Andere Bezeichnung: PIP4K2A (PIP4K2A Produkte)

Synonyme: PI5P4KA antikoerper, PIP5K2A antikoerper, PIP5KII-alpha antikoerper, PIP5KIIA antikoerper, PIPK antikoerper, AW742916 antikoerper, Pip5k2a antikoerper, pipk antikoerper, pi5p4ka antikoerper, pip5k2a antikoerper, pip5kiia antikoerper, pip4k2a antikoerper, zgc:194746 antikoerper, zgc:194777 antikoerper, phosphatidylinositol-5-phosphate 4-kinase type 2 alpha antikoerper, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha antikoerper, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha S homeolog antikoerper, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha a antikoerper, PIP4K2A antikoerper, Pip4k2a antikoerper, pip4k2a.S antikoerper, pip4k2a antikoerper, pip4k2aa antikoerper

Hintergrund: Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Inositol Metabolic Process