GCAP1 Antikörper

Produktnummer ABIN631244

Produktdetails anti-GCAP1 Antikörper

Target: GCAP1 (GUCA1A) (Guanylate Cyclase Activator 1A (Retina) (GUCA1A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GCAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GUCA1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GUCA1A Blocking Peptide, catalog no. 33R-5562, is also available for use as a blocking control in assays to test for specificity of this GUCA1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUCA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GCAP1

Target: GCAP1 (GUCA1A) (Guanylate Cyclase Activator 1A (Retina) (GUCA1A))

Andere Bezeichnung: GUCA1A (GUCA1A Produkte)

Synonyme: C6orf131 antikoerper, COD3 antikoerper, CORD14 antikoerper, GCAP antikoerper, GCAP1 antikoerper, GUCA antikoerper, GUCA1 antikoerper, dJ139D8.6 antikoerper, MGC84170 antikoerper, GUCA1A antikoerper, guca1a antikoerper, MGC146317 antikoerper, GC-A antikoerper, Gcap1 antikoerper, Guca1 antikoerper, mGCAP1 antikoerper, gcap1 antikoerper, guanylate cyclase activator 1A antikoerper, guanylate cyclase activator 1A L homeolog antikoerper, guanylate cyclase activator 1A (retina) antikoerper, guanylate cyclase activator 1a (retina) antikoerper, GUCA1A antikoerper, Guca1a antikoerper, guca1a.L antikoerper, guca1a antikoerper

Hintergrund: GUCA1A(GCAP1) plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction