IFT122 Antikörper

Produktnummer ABIN631200

Produktdetails anti-IFT122 Antikörper

Target: IFT122 (Intraflagellar Transport 122 (IFT122))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFT122 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: IFT122 antibody was raised using a synthetic peptide corresponding to a region with amino acids QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFT122 Blocking Peptide, catalog no. 33R-7457, is also available for use as a blocking control in assays to test for specificity of this IFT122 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT122 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFT122

Target: IFT122 (Intraflagellar Transport 122 (IFT122))

Andere Bezeichnung: IFT122 (IFT122 Produkte)

Synonyme: C86139 antikoerper, Wdr10 antikoerper, sopb antikoerper, CED antikoerper, CED1 antikoerper, SPG antikoerper, WDR10 antikoerper, WDR10p antikoerper, WDR140 antikoerper, intraflagellar transport 122 antikoerper, intraflagellar transport protein 122 homolog antikoerper, IFT122 antikoerper, ift122 antikoerper, LOC100639275 antikoerper, LOC100649523 antikoerper, Ift122 antikoerper

Hintergrund: IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.

Molekulargewicht: 129 kDa (MW of target protein)

Pathways: Tube Formation, Embryonic Body Morphogenesis