SULT1A1 Antikörper (N-Term)
-
- Target Alle SULT1A1 Antikörper anzeigen
- SULT1A1 (Sulfotransferase Family, Cytosolic, 1A, Phenol-Preferring, Member 1 (SULT1A1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SULT1A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SULT1 A1 antibody was raised against the N terminal of SULT1 1
- Aufreinigung
- Affinity purified
- Immunogen
- SULT1 A1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
- Top Product
- Discover our top product SULT1A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SULT1A1 Blocking Peptide, catalog no. 33R-2553, is also available for use as a blocking control in assays to test for specificity of this SULT1A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT1A1 (Sulfotransferase Family, Cytosolic, 1A, Phenol-Preferring, Member 1 (SULT1A1))
- Andere Bezeichnung
- SULT1A1 (SULT1A1 Produkte)
- Hintergrund
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity.
- Molekulargewicht
- 34 kDa (MW of target protein)
-