NRBP2 Antikörper (Middle Region)

Produktnummer ABIN631188

Produktdetails anti-NRBP2 Antikörper

Target: NRBP2

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NRBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NRBP2 antibody was raised against the middle region of NRBP2

Aufreinigung: Affinity purified

Immunogen: NRBP2 antibody was raised using the middle region of NRBP2 corresponding to a region with amino acids VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NRBP2 Blocking Peptide, catalog no. 33R-9607, is also available for use as a blocking control in assays to test for specificity of this NRBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NRBP2

Target: NRBP2

Andere Bezeichnung: NRBP2 (NRBP2 Produkte)

Synonyme: TRG16 antikoerper, pp9320 antikoerper, BC011468 antikoerper, nuclear receptor binding protein 2 antikoerper, Nrbp2 antikoerper, NRBP2 antikoerper

Hintergrund: The function of NRBP2 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)