ACTR2 Antikörper
-
- Target Alle ACTR2 Antikörper anzeigen
- ACTR2 (Actin-Related Protein 2 (ACTR2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACTR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDK
- Top Product
- Discover our top product ACTR2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACTR2 Blocking Peptide, catalog no. 33R-7879, is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTR2 (Actin-Related Protein 2 (ACTR2))
- Andere Bezeichnung
- ACTR2 (ACTR2 Produkte)
- Synonyme
- ARP2 antikoerper, 4921510D23Rik antikoerper, AA409782 antikoerper, Arp2 antikoerper, D6Ertd746e antikoerper, actr2 antikoerper, hm:zeh1257 antikoerper, zgc:63719 antikoerper, actr2-B antikoerper, arp2-B antikoerper, arp2 antikoerper, ACTR2 antikoerper, DKFZp459N093 antikoerper, ACTIN RELATED PROTEIN 2 antikoerper, ATARP2 antikoerper, WRM antikoerper, WURM antikoerper, actin related protein 2 antikoerper, actr2-A antikoerper, arp2-A antikoerper, zgc:110550 antikoerper, ARP2 actin related protein 2 homolog antikoerper, ARP2 actin-related protein 2 antikoerper, ARP2 actin related protein 2a homolog antikoerper, ARP2 actin-related protein 2 homolog L homeolog antikoerper, ARP2 actin-related protein 2 homolog antikoerper, actin-related protein Arp2 antikoerper, actin related protein 2 antikoerper, ARP2 actin-related protein 2 homolog S homeolog antikoerper, ARP2 actin related protein 2b homolog antikoerper, ARP2/3 actin-organizing complex subunit Arp2 antikoerper, ACTR2 antikoerper, Actr2 antikoerper, actr2a antikoerper, actr2.L antikoerper, actr2 antikoerper, arp2 antikoerper, ARP2 antikoerper, actr2.S antikoerper, actr2b antikoerper
- Hintergrund
- ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. The specific function of this gene has not yet been determined.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- RTK Signalweg, Regulation of Actin Filament Polymerization
-