TRIM63 Antikörper (Middle Region)

Produktnummer ABIN631125

Produktdetails anti-TRIM63 Antikörper

Target: TRIM63 (Tripartite Motif Containing 63 (TRIM63))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM63 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM63 antibody was raised against the middle region of TRIM63

Aufreinigung: Affinity purified

Immunogen: TRIM63 antibody was raised using the middle region of TRIM63 corresponding to a region with amino acids EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM63 Blocking Peptide, catalog no. 33R-2669, is also available for use as a blocking control in assays to test for specificity of this TRIM63 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM63 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM63

Target: TRIM63 (Tripartite Motif Containing 63 (TRIM63))

Andere Bezeichnung: TRIM63 (TRIM63 Produkte)

Synonyme: IRF antikoerper, MURF1 antikoerper, MURF2 antikoerper, RNF28 antikoerper, SMRZ antikoerper, Murf antikoerper, Murf1 antikoerper, Rnf28 antikoerper, MuRF1 antikoerper, RF1 antikoerper, rnf30 antikoerper, MGC80210 antikoerper, TRIM63 antikoerper, MuRF antikoerper, fc50c07 antikoerper, trim63 antikoerper, wu:fc50c07 antikoerper, zgc:86757 antikoerper, tripartite motif containing 63 antikoerper, tripartite motif-containing 63 antikoerper, tripartite motif containing 63 S homeolog antikoerper, tripartite motif containing 63a antikoerper, TRIM63 antikoerper, Trim63 antikoerper, trim63.S antikoerper, trim63a antikoerper

Hintergrund: This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titin's N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle.

Molekulargewicht: 40 kDa (MW of target protein)