TTL Antikörper (Middle Region)

Produktnummer ABIN631103

Produktdetails anti-TTL Antikörper

Target: TTL (Tubulin tyrosine Ligase (TTL))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TTL antibody was raised against the middle region of TTL

Aufreinigung: Affinity purified

Immunogen: TTL antibody was raised using the middle region of TTL corresponding to a region with amino acids LYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TTL Blocking Peptide, catalog no. 33R-5571, is also available for use as a blocking control in assays to test for specificity of this TTL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTL

Target: TTL (Tubulin tyrosine Ligase (TTL))

Andere Bezeichnung: TTL (TTL Produkte)

Synonyme: 2410003M22Rik antikoerper, 2700049H19Rik antikoerper, AI848570 antikoerper, wu:fb93a09 antikoerper, zgc:153332 antikoerper, tubulin tyrosine ligase antikoerper, Ttl antikoerper, TTL antikoerper, ttl antikoerper

Hintergrund: TTL catalyzes the post-translational addition of a tyrosine to the C-terminal end of detyrosinated alpha-tubulin.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Regulation of Cell Size