TTL Antikörper (Middle Region)
-
- Target Alle TTL Antikörper anzeigen
- TTL (Tubulin tyrosine Ligase (TTL))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TTL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TTL antibody was raised against the middle region of TTL
- Aufreinigung
- Affinity purified
- Immunogen
- TTL antibody was raised using the middle region of TTL corresponding to a region with amino acids LYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFF
- Top Product
- Discover our top product TTL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TTL Blocking Peptide, catalog no. 33R-5571, is also available for use as a blocking control in assays to test for specificity of this TTL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTL (Tubulin tyrosine Ligase (TTL))
- Andere Bezeichnung
- TTL (TTL Produkte)
- Synonyme
- 2410003M22Rik antikoerper, 2700049H19Rik antikoerper, AI848570 antikoerper, wu:fb93a09 antikoerper, zgc:153332 antikoerper, tubulin tyrosine ligase antikoerper, Ttl antikoerper, TTL antikoerper, ttl antikoerper
- Hintergrund
- TTL catalyzes the post-translational addition of a tyrosine to the C-terminal end of detyrosinated alpha-tubulin.
- Molekulargewicht
- 43 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-