RPS21 Antikörper (Middle Region)
-
- Target Alle RPS21 Antikörper anzeigen
- RPS21 (Ribosomal Protein S21 (RPS21))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPS21 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPS21 antibody was raised against the middle region of RPS21
- Aufreinigung
- Affinity purified
- Immunogen
- RPS21 antibody was raised using the middle region of RPS21 corresponding to a region with amino acids NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF
- Top Product
- Discover our top product RPS21 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPS21 Blocking Peptide, catalog no. 33R-6907, is also available for use as a blocking control in assays to test for specificity of this RPS21 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS21 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS21 (Ribosomal Protein S21 (RPS21))
- Andere Bezeichnung
- RPS21 (RPS21 Produkte)
- Synonyme
- CG2986 antikoerper, Dmel\\CG2986 antikoerper, M(2)23B antikoerper, l(2)03575 antikoerper, l(2)168/14 antikoerper, l(2)k16814 antikoerper, oho23 antikoerper, oho23B antikoerper, rpS21 antikoerper, RPS21 antikoerper, S21 antikoerper, 1810049N11Rik antikoerper, 2410030A14Rik antikoerper, zgc:56642 antikoerper, zgc:86816 antikoerper, Ribosomal protein S21 antikoerper, 40S ribosomal protein S21 antikoerper, ribosomal protein S21 antikoerper, ribosomal protein S21 S homeolog antikoerper, RpS21 antikoerper, rps21b antikoerper, rps-21 antikoerper, RPS21 antikoerper, Rps21 antikoerper, rps21 antikoerper, rps21.S antikoerper
- Hintergrund
- The function of RPS21 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 9 kDa (MW of target protein)
-