GATM Antikörper

Produktnummer ABIN631084

Produktdetails anti-GATM Antikörper

Target: GATM (Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GATM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GATM antibody was raised using a synthetic peptide corresponding to a region with amino acids PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GATM Blocking Peptide, catalog no. 33R-6995, is also available for use as a blocking control in assays to test for specificity of this GATM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GATM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GATM

Target: GATM (Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM))

Andere Bezeichnung: GATM (GATM Produkte)

Synonyme: AT antikoerper, AGAT antikoerper, CCDS3 antikoerper, 1810003P21Rik antikoerper, AI314789 antikoerper, cb409 antikoerper, wu:fa08a06 antikoerper, zgc:65855 antikoerper, glycine amidinotransferase (L-arginine:glycine amidinotransferase) L homeolog antikoerper, glycine amidinotransferase antikoerper, glycine amidinotransferase (L-arginine:glycine amidinotransferase) antikoerper, gatm.L antikoerper, GATM antikoerper, Gatm antikoerper, gatm antikoerper

Hintergrund: GATM is a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.

Molekulargewicht: 44 kDa (MW of target protein)