NKD2 Antikörper

Produktnummer ABIN631060

Produktdetails anti-NKD2 Antikörper

Target: NKD2 (Naked Cuticle Homolog 2 (NKD2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NKD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NKD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGER

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NKD2 Blocking Peptide, catalog no. 33R-1463, is also available for use as a blocking control in assays to test for specificity of this NKD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NKD2

Target: NKD2 (Naked Cuticle Homolog 2 (NKD2))

Andere Bezeichnung: NKD2 (NKD2 Produkte)

Synonyme: nkd2 antikoerper, nkd2l antikoerper, 2210403L10Rik antikoerper, AW212591 antikoerper, Naked2 antikoerper, naked cuticle homolog 2b antikoerper, naked cuticle 2 homolog (Drosophila) antikoerper, naked cuticle homolog 2 antikoerper, naked cuticle homolog 2a antikoerper, nkd2b antikoerper, Nkd2 antikoerper, NKD2 antikoerper, nkd2a antikoerper

Hintergrund: In the mouse, NkDa is a Dishevelled-binding protein that functions as a negative regulator of the Wnt-beta-catenin-Tcf signaling pathway.

Molekulargewicht: 34 kDa (MW of target protein)