ATP5F1 Antikörper (Middle Region)

Produktnummer ABIN631028

Produktdetails anti-ATP5F1 Antikörper

Target: ATP5F1 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit B1 (ATP5F1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP5F1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP5 F1 antibody was raised against the middle region of ATP5 1

Aufreinigung: Affinity purified

Immunogen: ATP5 F1 antibody was raised using the middle region of ATP5 1 corresponding to a region with amino acids VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP5F1 Blocking Peptide, catalog no. 33R-9863, is also available for use as a blocking control in assays to test for specificity of this ATP5F1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP5F1

Target: ATP5F1 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit B1 (ATP5F1))

Andere Bezeichnung: ATP5F1 (ATP5F1 Produkte)

Synonyme: PIG47 antikoerper, C76477 antikoerper, wu:fb59g11 antikoerper, wu:fj08b08 antikoerper, zgc:101887 antikoerper, ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1 antikoerper, ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1 S homeolog antikoerper, ATP synthase F(0) complex subunit B1, mitochondrial antikoerper, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1 antikoerper, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 antikoerper, ATP5F1 antikoerper, atp5f1.S antikoerper, atp5f1 antikoerper, LOC479901 antikoerper, Atp5f1 antikoerper

Hintergrund: ATP5F1 is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8).

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process