CDT2/RAMP Antikörper

Produktnummer ABIN630978

Produktdetails anti-CDT2/RAMP Antikörper

Target: CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDT2/RAMP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DTL Blocking Peptide, catalog no. 33R-9712, is also available for use as a blocking control in assays to test for specificity of this DTL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDT2/RAMP

Target: CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))

Andere Bezeichnung: DTL (DTL Produkte)

Synonyme: CDT2 antikoerper, DCAF2 antikoerper, L2DTL antikoerper, RAMP antikoerper, 2810047L02Rik antikoerper, 5730564G15Rik antikoerper, Ramp antikoerper, RGD1310439 antikoerper, cdt2 antikoerper, cdt2-a antikoerper, dcaf2 antikoerper, l2dtl antikoerper, ramp antikoerper, cb151 antikoerper, chunp6871 antikoerper, wu:fb54b02 antikoerper, denticleless E3 ubiquitin protein ligase homolog antikoerper, denticleless E3 ubiquitin protein ligase antikoerper, denticleless E3 ubiquitin protein ligase homolog S homeolog antikoerper, denticleless E3 ubiquitin protein ligase homolog (Drosophila) antikoerper, DTL antikoerper, Dtl antikoerper, dtl.S antikoerper, dtl antikoerper

Hintergrund: DTL is required for CDT1 proteolysis in response to DNA damage through the CUL4-DDB1 E3 ubiquitin-protein ligase. It seems to be necessary to ensure proper cell cycle regulation of DNA replication. DTL may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. It also may play a role in cell proliferation of NT2 embryonal carcinoma cells.

Molekulargewicht: 79 kDa (MW of target protein)