CCNDBP1 Antikörper (Middle Region)
-
- Target Alle CCNDBP1 Antikörper anzeigen
- CCNDBP1 (Cyclin D-Type Binding-Protein 1 (CCNDBP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCNDBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cyclin D-Type Binding-Protein 1 antibody was raised against the middle region of CCNDBP1
- Aufreinigung
- Affinity purified
- Immunogen
- Cyclin D-Type Binding-Protein 1 antibody was raised using the middle region of CCNDBP1 corresponding to a region with amino acids KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN
- Top Product
- Discover our top product CCNDBP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cyclin D-Type Binding-Protein 1 Blocking Peptide, catalog no. 33R-4575, is also available for use as a blocking control in assays to test for specificity of this Cyclin D-Type Binding-Protein 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNDBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCNDBP1 (Cyclin D-Type Binding-Protein 1 (CCNDBP1))
- Andere Bezeichnung
- Cyclin D-Type Binding-Protein 1 (CCNDBP1 Produkte)
- Synonyme
- CCNDBP1 antikoerper, dip1 antikoerper, gcip antikoerper, DIP1 antikoerper, GCIP antikoerper, HHM antikoerper, AU022347 antikoerper, Maid antikoerper, SECC-8 antikoerper, SSEC-8 antikoerper, cyclin D1 binding protein 1 antikoerper, cyclin D-type binding-protein 1 antikoerper, CCNDBP1 antikoerper, ccndbp1 antikoerper, Ccndbp1 antikoerper
- Hintergrund
- This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D.
- Molekulargewicht
- 40 kDa (MW of target protein)
-