VPS4A Antikörper
-
- Target Alle VPS4A Antikörper anzeigen
- VPS4A (Vacuolar Protein Sorting-Associated Protein 4A (VPS4A))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VPS4A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- VPS4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE
- Top Product
- Discover our top product VPS4A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VPS4A Blocking Peptide, catalog no. 33R-10096, is also available for use as a blocking control in assays to test for specificity of this VPS4A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS4A (Vacuolar Protein Sorting-Associated Protein 4A (VPS4A))
- Andere Bezeichnung
- VPS4A (VPS4A Produkte)
- Synonyme
- vsp4 antikoerper, SKD1 antikoerper, SKD1A antikoerper, SKD2 antikoerper, VPS4 antikoerper, VPS4-1 antikoerper, zgc:153907 antikoerper, 4930589C15Rik antikoerper, AI325971 antikoerper, AW553189 antikoerper, vacuolar protein sorting 4 homolog A antikoerper, vacuolar sorting protein 4 antikoerper, vacuolar protein sorting 4 homolog A L homeolog antikoerper, vacuolar protein sorting 4a homolog A (S. cerevisiae) antikoerper, vacuolar protein sorting 4A antikoerper, VPS4A antikoerper, TP03_0351 antikoerper, vps4a antikoerper, vps4a.L antikoerper, Vps4a antikoerper
- Hintergrund
- VPS4A is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics, CXCR4-mediated Signaling Events
-