Band 3/AE1 Antikörper

Produktnummer ABIN630943

Produktdetails anti-Band 3/AE1 Antikörper

Target: Band 3/AE1 (SLC4A1) (Solute Carrier Family 4, Anion Exchanger, Member 1 (erythrocyte Membrane Protein Band 3, Diego Blood Group) (SLC4A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Band 3/AE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC4 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR

Anwendungsinformationen

Applikationshinweise: WB: 0.1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC4A1 Blocking Peptide, catalog no. 33R-7368, is also available for use as a blocking control in assays to test for specificity of this SLC4A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Band 3/AE1

Target: Band 3/AE1 (SLC4A1) (Solute Carrier Family 4, Anion Exchanger, Member 1 (erythrocyte Membrane Protein Band 3, Diego Blood Group) (SLC4A1))

Andere Bezeichnung: SLC4A1 (SLC4A1 Produkte)

Synonyme: AE1 antikoerper, BND3 antikoerper, CD233 antikoerper, DI antikoerper, EMPB3 antikoerper, EPB3 antikoerper, FR antikoerper, RTA1A antikoerper, SW antikoerper, WD antikoerper, WD1 antikoerper, WR antikoerper, Ae1 antikoerper, Empb3 antikoerper, l11Jus51 antikoerper, ae1 antikoerper, band3 antikoerper, MGC152771 antikoerper, zgc:111889 antikoerper, zgc:152771 antikoerper, si:dz180g5.1 antikoerper, LOC100136769 antikoerper, slc4a1 antikoerper, wd1 antikoerper, bnd3 antikoerper, epb3 antikoerper, cd233 antikoerper, empb3 antikoerper, rta1a antikoerper, MGC80391 antikoerper, SLC4A1 antikoerper, BB3 antikoerper, EAT antikoerper, solute carrier family 4 member 1 (Diego blood group) antikoerper, solute carrier family 4 (anion exchanger), member 1 antikoerper, solute carrier family 4 (anion exchanger), member 1a (Diego blood group) antikoerper, Band 3 antikoerper, erythrocyte membrane protein band 4.1 like 3 antikoerper, solute carrier family 4 member 1 (Diego blood group) L homeolog antikoerper, solute carrier family 4 member 1 antikoerper, SLC4A1 antikoerper, Slc4a1 antikoerper, slc4a1a antikoerper, LOC100136769 antikoerper, EPB41L3 antikoerper, slc4a1.L antikoerper, slc4a1 antikoerper

Hintergrund: The CD233 gene is located on chromosome 17q21-q22 and is part of the anion exchanger (AE) family. CD233 is expressed in the erythrocyte plasma membrane where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40 kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. CD233 associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of CD233.

Molekulargewicht: 102 kDa (MW of target protein)