KIR2DL4/CD158d Antikörper (Middle Region)
-
- Target Alle KIR2DL4/CD158d (KIR2DL4) Antikörper anzeigen
- KIR2DL4/CD158d (KIR2DL4) (Killer Cell Immunoglobulin-Like Receptor, Two Domains, Long Cytoplasmic Tail, 4 (KIR2DL4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIR2DL4/CD158d Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIR2 DL4 antibody was raised against the middle region of KIR2 L4
- Aufreinigung
- Affinity purified
- Immunogen
- KIR2 DL4 antibody was raised using the middle region of KIR2 L4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
- Top Product
- Discover our top product KIR2DL4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIR2DL4 Blocking Peptide, catalog no. 33R-9831, is also available for use as a blocking control in assays to test for specificity of this KIR2DL4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIR0 L4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIR2DL4/CD158d (KIR2DL4) (Killer Cell Immunoglobulin-Like Receptor, Two Domains, Long Cytoplasmic Tail, 4 (KIR2DL4))
- Andere Bezeichnung
- KIR2DL4 (KIR2DL4 Produkte)
- Synonyme
- G9P antikoerper, CD158D antikoerper, KIR103 antikoerper, KIR103AS antikoerper, KIR2DL4 antikoerper, killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4 antikoerper, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 antikoerper, KIR2DL4 antikoerper
- Hintergrund
- Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells.
- Molekulargewicht
- 30 kDa (MW of target protein)
-