GCET2 Antikörper (Middle Region)
-
- Target Alle GCET2 Antikörper anzeigen
- GCET2 (Germinal Center Expressed Transcript 2 (GCET2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GCET2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GCET2 antibody was raised against the middle region of GCET2
- Aufreinigung
- Affinity purified
- Immunogen
- GCET2 antibody was raised using the middle region of GCET2 corresponding to a region with amino acids YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH
- Top Product
- Discover our top product GCET2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GCET2 Blocking Peptide, catalog no. 33R-10243, is also available for use as a blocking control in assays to test for specificity of this GCET2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCET2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCET2 (Germinal Center Expressed Transcript 2 (GCET2))
- Andere Bezeichnung
- GCET2 (GCET2 Produkte)
- Synonyme
- Gcet antikoerper, Gcet2 antikoerper, M17 antikoerper, M17-L antikoerper, GCAT2 antikoerper, GCET2 antikoerper, HGAL antikoerper, germinal center associated, signaling and motility antikoerper, germinal center associated signaling and motility antikoerper, germinal center-associated, signaling and motility antikoerper, Gcsam antikoerper, GCSAM antikoerper
- Hintergrund
- GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4.
- Molekulargewicht
- 21 kDa (MW of target protein)
-