ATP6V0D2 Antikörper (Middle Region)
-
- Target Alle ATP6V0D2 Antikörper anzeigen
- ATP6V0D2 (ATPase, H+ Transporting, Lysosomal 38kDa, V0 Subunit D2 (ATP6V0D2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP6V0D2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ATP6 V6 2 antibody was raised against the middle region of ATP6 6 2
- Aufreinigung
- Affinity purified
- Immunogen
- ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
- Top Product
- Discover our top product ATP6V0D2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATP6V0D2 Blocking Peptide, catalog no. 33R-3417, is also available for use as a blocking control in assays to test for specificity of this ATP6V0D2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP6V0D2 (ATPase, H+ Transporting, Lysosomal 38kDa, V0 Subunit D2 (ATP6V0D2))
- Andere Bezeichnung
- ATP6V0D2 (ATP6V0D2 Produkte)
- Synonyme
- ATP6D2 antikoerper, VMA6 antikoerper, AI324824 antikoerper, V-ATPase antikoerper, 1620401A02Rik antikoerper, ATPase H+ transporting V0 subunit d2 antikoerper, ATPase, H+ transporting, lysosomal V0 subunit D2 antikoerper, ATPase H+ transporting V0 subunit D2 antikoerper, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 L homeolog antikoerper, ATP6V0D2 antikoerper, Atp6v0d2 antikoerper, atp6v0d2.L antikoerper
- Hintergrund
- ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Proton Transport
-