PSMB4 Antikörper

Produktnummer ABIN630916

Produktdetails anti-PSMB4 Antikörper

Target: PSMB4 (Proteasome (Prosome, Macropain) Subunit, beta Type, 4 (PSMB4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMB4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMB4 Blocking Peptide, catalog no. 33R-8775, is also available for use as a blocking control in assays to test for specificity of this PSMB4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMB4

Target: PSMB4 (Proteasome (Prosome, Macropain) Subunit, beta Type, 4 (PSMB4))

Andere Bezeichnung: PSMB4 (PSMB4 Produkte)

Synonyme: An18g06680 antikoerper, PSMB4 antikoerper, Pros-27 antikoerper, HN3 antikoerper, HsN3 antikoerper, PROS-26 antikoerper, PROS26 antikoerper, im:6909492 antikoerper, zgc:110330 antikoerper, proteasome subunit beta type-4 antikoerper, proteasome subunit beta 4 antikoerper, proteasome (prosome, macropain) subunit, beta type 4 antikoerper, proteasome subunit beta 4 L homeolog antikoerper, ANI_1_890164 antikoerper, PSMB4 antikoerper, psmb4 antikoerper, Psmb4 antikoerper, psmb4.L antikoerper

Hintergrund: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB4 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA