PSMA3 Antikörper
-
- Target Alle PSMA3 Antikörper anzeigen
- PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN
- Top Product
- Discover our top product PSMA3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSMA3 Blocking Peptide, catalog no. 33R-9616, is also available for use as a blocking control in assays to test for specificity of this PSMA3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))
- Andere Bezeichnung
- PSMA3 (PSMA3 Produkte)
- Synonyme
- HC8 antikoerper, PSC3 antikoerper, Psma3l antikoerper, psma3 antikoerper, im:6909944 antikoerper, zgc:114044 antikoerper, Lmpc8 antikoerper, proteasome subunit alpha 3 antikoerper, proteasome subunit alpha 3 L homeolog antikoerper, proteasome (prosome, macropain) subunit, alpha type 3 antikoerper, PSMA3 antikoerper, Psma3 antikoerper, psma3.L antikoerper, psma3 antikoerper
- Hintergrund
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-