PSMA3 Antikörper

Produktnummer ABIN630882

Produktdetails anti-PSMA3 Antikörper

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMA3 Blocking Peptide, catalog no. 33R-9616, is also available for use as a blocking control in assays to test for specificity of this PSMA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMA3

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Andere Bezeichnung: PSMA3 (PSMA3 Produkte)

Synonyme: HC8 antikoerper, PSC3 antikoerper, Psma3l antikoerper, psma3 antikoerper, im:6909944 antikoerper, zgc:114044 antikoerper, Lmpc8 antikoerper, proteasome subunit alpha 3 antikoerper, proteasome subunit alpha 3 L homeolog antikoerper, proteasome (prosome, macropain) subunit, alpha type 3 antikoerper, PSMA3 antikoerper, Psma3 antikoerper, psma3.L antikoerper, psma3 antikoerper

Hintergrund: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA