XRCC4 Antikörper (Middle Region)
-
- Target Alle XRCC4 Antikörper anzeigen
- XRCC4 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser XRCC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- XRCC4 antibody was raised against the middle region of XRCC4
- Aufreinigung
- Affinity purified
- Immunogen
- XRCC4 antibody was raised using the middle region of XRCC4 corresponding to a region with amino acids LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS
- Top Product
- Discover our top product XRCC4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
XRCC4 Blocking Peptide, catalog no. 33R-5319, is also available for use as a blocking control in assays to test for specificity of this XRCC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XRCC4 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4))
- Andere Bezeichnung
- XRCC4 (XRCC4 Produkte)
- Synonyme
- zgc:73312 antikoerper, MGC81443 antikoerper, homolog of human DNA ligase iv-binding protein XRCC4 antikoerper, 2310057B22Rik antikoerper, AW413319 antikoerper, AW545101 antikoerper, X-ray repair cross complementing 4 antikoerper, X-ray repair complementing defective repair in Chinese hamster cells 4 antikoerper, X-ray repair complementing defective repair in Chinese hamster cells 4 L homeolog antikoerper, DNA ligase IV-binding protein antikoerper, XRCC4 antikoerper, xrcc4 antikoerper, xrcc4.L antikoerper, Xrcc4 antikoerper
- Hintergrund
- XRCC4 functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes.
- Molekulargewicht
- 38 kDa (MW of target protein)
- Pathways
- DNA Reparatur, Production of Molecular Mediator of Immune Response
-