PPIL2 Antikörper

Produktnummer ABIN630873

Produktdetails anti-PPIL2 Antikörper

Target: PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPIL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPIL2 Blocking Peptide, catalog no. 33R-3545, is also available for use as a blocking control in assays to test for specificity of this PPIL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPIL2

Target: PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))

Andere Bezeichnung: PPIL2 (PPIL2 Produkte)

Synonyme: cyc4 antikoerper, cyp60 antikoerper, hcyp-60 antikoerper, CYC4 antikoerper, CYP60 antikoerper, Cyp-60 antikoerper, UBOX7 antikoerper, hCyP-60 antikoerper, 0610009L05Rik antikoerper, 1700016N17Rik antikoerper, 4921520K19Rik antikoerper, 4930511F14Rik antikoerper, AA589416 antikoerper, C130078A06Rik antikoerper, si:dkeyp-86g2.1 antikoerper, zgc:56616 antikoerper, zgc:86735 antikoerper, peptidylprolyl isomerase like 2 S homeolog antikoerper, peptidylprolyl isomerase like 2 antikoerper, peptidylprolyl isomerase (cyclophilin)-like 2 antikoerper, ppil2.S antikoerper, PPIL2 antikoerper, ppil2 antikoerper, Ppil2 antikoerper

Hintergrund: PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.

Molekulargewicht: 59 kDa (MW of target protein)