FANCE Antikörper (Middle Region)

Produktnummer ABIN630869

Produktdetails anti-FANCE Antikörper

Target: FANCE (Fanconi Anemia, Complementation Group E (FANCE))

Bindungsspezifität: AA 1-13, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FANCE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FANCE antibody was raised against the middle region of FANCE

Aufreinigung: Affinity purified

Immunogen: FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FANCE Blocking Peptide, catalog no. 33R-8689, is also available for use as a blocking control in assays to test for specificity of this FANCE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FANCE

Target: FANCE (Fanconi Anemia, Complementation Group E (FANCE))

Andere Bezeichnung: FANCE (FANCE Produkte)

Synonyme: FANCE antikoerper, fae antikoerper, face antikoerper, FACE antikoerper, FAE antikoerper, 2810451D06Rik antikoerper, AI415634 antikoerper, AW209126 antikoerper, RGD1561045 antikoerper, Fanconi anemia complementation group E antikoerper, Fanconi anemia, complementation group E antikoerper, FANCE antikoerper, fance antikoerper, Fance antikoerper

Hintergrund: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: DNA Reparatur