FLII Antikörper

Produktnummer ABIN630840

Produktdetails anti-FLII Antikörper

Target: FLII (Flightless I Homolog (FLII))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FLII Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FLII antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLII Blocking Peptide, catalog no. 33R-4761, is also available for use as a blocking control in assays to test for specificity of this FLII antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLII antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FLII

Target: FLII (Flightless I Homolog (FLII))

Andere Bezeichnung: FLII (FLII Produkte)

Synonyme: FLI antikoerper, FLIL antikoerper, Fli1 antikoerper, 3632430F08Rik antikoerper, Fliih antikoerper, im:7141769 antikoerper, DKFZp459O043 antikoerper, flightless antikoerper, FLII, actin remodeling protein antikoerper, flightless I actin binding protein antikoerper, protein flightless-1 homolog antikoerper, FLII, actin remodeling protein S homeolog antikoerper, Protein flightless-1 homolog antikoerper, FLII antikoerper, Flii antikoerper, flii antikoerper, LOC585336 antikoerper, LOC100640615 antikoerper, flii.S antikoerper, fli-1 antikoerper

Hintergrund: FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Molekulargewicht: 145 kDa (MW of target protein)