DTX2 Antikörper

Produktnummer ABIN630801

Produktdetails anti-DTX2 Antikörper

Target: DTX2 (Deltex Homolog 2 (DTX2))

Reaktivität: Human, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DTX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DTX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DTX2 Blocking Peptide, catalog no. 33R-2305, is also available for use as a blocking control in assays to test for specificity of this DTX2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTX2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DTX2

Target: DTX2 (Deltex Homolog 2 (DTX2))

Andere Bezeichnung: DTX2 (DTX2 Produkte)

Synonyme: RNF58 antikoerper, 2610524D08Rik antikoerper, AA408415 antikoerper, AU022494 antikoerper, Deltex2 antikoerper, dtx2 antikoerper, deltex E3 ubiquitin ligase 2 antikoerper, probable E3 ubiquitin-protein ligase DTX2 antikoerper, deltex 2, E3 ubiquitin ligase antikoerper, deltex 2, E3 ubiquitin ligase S homeolog antikoerper, DTX2 antikoerper, Dtx2 antikoerper, LOC735784 antikoerper, LOC747633 antikoerper, dtx2 antikoerper, dtx2.S antikoerper

Hintergrund: DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Notch Signalweg