AKTIP Antikörper (Middle Region)

Produktnummer ABIN630793

Produktdetails anti-AKTIP Antikörper

Target: AKTIP (AKT Interacting Protein (AKTIP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKTIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AKTIP antibody was raised against the middle region of AKTIP

Aufreinigung: Affinity purified

Immunogen: AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKTIP Blocking Peptide, catalog no. 33R-6833, is also available for use as a blocking control in assays to test for specificity of this AKTIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKTIP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKTIP

Target: AKTIP (AKT Interacting Protein (AKTIP))

Andere Bezeichnung: AKTIP (AKTIP Produkte)

Synonyme: FT1 antikoerper, FTS antikoerper, cb798 antikoerper, fts antikoerper, zgc:77699 antikoerper, fts-A antikoerper, aktip antikoerper, fts-B antikoerper, MGC133931 antikoerper, AL023020 antikoerper, Fif antikoerper, Ft antikoerper, Ft1 antikoerper, Fts antikoerper, AKT interacting protein antikoerper, akt interacting protein antikoerper, AKT interacting protein L homeolog antikoerper, AKT interacting protein S homeolog antikoerper, thymoma viral proto-oncogene 1 interacting protein antikoerper, AKTIP antikoerper, aktip antikoerper, aktip.L antikoerper, aktip.S antikoerper, Aktip antikoerper

Hintergrund: AKTIP is the component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). AKTIP regulates apoptosis by enhancing phosphorylation and activation of AKT1. AKTIP increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade.

Molekulargewicht: 33 kDa (MW of target protein)