Peroxiredoxin 3 Antikörper (N-Term)

Produktnummer ABIN630744

Produktdetails anti-Peroxiredoxin 3 Antikörper

Target: Peroxiredoxin 3 (PRDX3)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peroxiredoxin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Peroxiredoxin 3 antibody was raised against the N terminal of PRDX3

Aufreinigung: Affinity purified

Immunogen: Peroxiredoxin 3 antibody was raised using the N terminal of PRDX3 corresponding to a region with amino acids AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Peroxiredoxin 3 Blocking Peptide, catalog no. 33R-1279, is also available for use as a blocking control in assays to test for specificity of this Peroxiredoxin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of Peroxiredoxin 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Peroxiredoxin 3

Target: Peroxiredoxin 3 (PRDX3)

Andere Bezeichnung: Peroxiredoxin 3 (PRDX3 Produkte)

Synonyme: cb718 antikoerper, wu:fk49e09 antikoerper, zgc:110282 antikoerper, zgc:112512 antikoerper, MGC83969 antikoerper, PRDX3 antikoerper, AOP-1 antikoerper, AOP1 antikoerper, HBC189 antikoerper, MER5 antikoerper, PRO1748 antikoerper, SP-22 antikoerper, prx-III antikoerper, AW822249 antikoerper, Aop1 antikoerper, D0Tohi1 antikoerper, Ef2l antikoerper, Mer5 antikoerper, Prx3 antikoerper, SP22 antikoerper, TDXM antikoerper, MTAP antikoerper, peroxiredoxin 3 antikoerper, peroxiredoxin 3 S homeolog antikoerper, peroxiredoxin PRX3 antikoerper, prdx3 antikoerper, PRDX3 antikoerper, prdx3.S antikoerper, PRX3 antikoerper, Prdx3 antikoerper

Hintergrund: PRDX3 is a protein with antioxidant function and is localized in the mitochondrion. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process