GSTT1 Antikörper (C-Term)
-
- Target Alle GSTT1 Antikörper anzeigen
- GSTT1 (Glutathione S-Transferase theta 1 (GSTT1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GSTT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GSTT1 antibody was raised against the C terminal of GSTT1
- Aufreinigung
- Affinity purified
- Immunogen
- GSTT1 antibody was raised using the C terminal of GSTT1 corresponding to a region with amino acids TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
- Top Product
- Discover our top product GSTT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GSTT1 Blocking Peptide, catalog no. 33R-9381, is also available for use as a blocking control in assays to test for specificity of this GSTT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTT1 (Glutathione S-Transferase theta 1 (GSTT1))
- Andere Bezeichnung
- GSTT1 (GSTT1 Produkte)
- Synonyme
- GSTT1 antikoerper, LOC100285763 antikoerper, cb870 antikoerper, gstt1 antikoerper, AI255817 antikoerper, Gstt1-1 antikoerper, GSTYRS antikoerper, zgc:65964 antikoerper, glutathione S-transferase theta 1 antikoerper, glutathione S-transferase theta-4 antikoerper, glutathione S-transferase theta-1 antikoerper, glutathione S-transferase theta 1a antikoerper, glutathione S-transferase, theta 1 antikoerper, glutathione S-transferase theta 1 L homeolog antikoerper, glutathione S-transferase theta 1b antikoerper, GSTT1 antikoerper, LOC700446 antikoerper, LOC100285763 antikoerper, gstt1a antikoerper, Gstt1 antikoerper, LOC477556 antikoerper, LOC100153094 antikoerper, LOC100338194 antikoerper, gstt1.L antikoerper, gstt1b antikoerper
- Hintergrund
- Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis.
- Molekulargewicht
- 27 kDa (MW of target protein)
-