MNS1 Antikörper (Middle Region)

Produktnummer ABIN630722

Produktdetails anti-MNS1 Antikörper

Target: MNS1 (Meiosis-Specific Nuclear Structural 1 (MNS1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MNS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MNS1 antibody was raised against the middle region of MNS1

Aufreinigung: Affinity purified

Immunogen: MNS1 antibody was raised using the middle region of MNS1 corresponding to a region with amino acids KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MNS1 Blocking Peptide, catalog no. 33R-4719, is also available for use as a blocking control in assays to test for specificity of this MNS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MNS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MNS1

Target: MNS1 (Meiosis-Specific Nuclear Structural 1 (MNS1))

Andere Bezeichnung: MNS1 (MNS1 Produkte)

Synonyme: SPATA40 antikoerper, sb:cb494 antikoerper, zgc:65845 antikoerper, AW546487 antikoerper, meiosis specific nuclear structural 1 antikoerper, meiosis-specific nuclear structural 1 antikoerper, meiosis-specific nuclear structural protein 1 antikoerper, MNS1 antikoerper, mns1 antikoerper, Mns1 antikoerper

Hintergrund: This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein.

Molekulargewicht: 60 kDa (MW of target protein)