POLR3H Antikörper (Middle Region)

Produktnummer ABIN630707

Produktdetails anti-POLR3H Antikörper

Target: POLR3H (Polymerase (RNA) III (DNA Directed) Polypeptide H (22.9kD) (POLR3H))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLR3H Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: POLR3 H antibody was raised against the middle region of POLR3

Aufreinigung: Affinity purified

Immunogen: POLR3 H antibody was raised using the middle region of POLR3 corresponding to a region with amino acids AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLR3H Blocking Peptide, catalog no. 33R-1242, is also available for use as a blocking control in assays to test for specificity of this POLR3H antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLR3H

Target: POLR3H (Polymerase (RNA) III (DNA Directed) Polypeptide H (22.9kD) (POLR3H))

Andere Bezeichnung: POLR3H (POLR3H Produkte)

Synonyme: 5031409G22Rik antikoerper, RPC8 antikoerper, RPC22.9 antikoerper, polymerase (RNA) III (DNA directed) polypeptide H antikoerper, RNA polymerase III subunit H antikoerper, Polr3h antikoerper, POLR3H antikoerper

Hintergrund: POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.

Molekulargewicht: 20 kDa (MW of target protein)