Trmt11 Antikörper

Produktnummer ABIN630683

Produktdetails anti-Trmt11 Antikörper

Target: Trmt11 (tRNA Methyltransferase 11 Homolog (Trmt11))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Trmt11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TRMT11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRMT11 Blocking Peptide, catalog no. 33R-4021, is also available for use as a blocking control in assays to test for specificity of this TRMT11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMT11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Trmt11

Target: Trmt11 (tRNA Methyltransferase 11 Homolog (Trmt11))

Andere Bezeichnung: TRMT11 (Trmt11 Produkte)

Synonyme: 2410075D05Rik antikoerper, 3110045I18Rik antikoerper, AW213713 antikoerper, Mds024 antikoerper, MDS024 antikoerper, C6orf75 antikoerper, TRM11 antikoerper, TRMT11-1 antikoerper, tRNA methyltransferase 11 antikoerper, tRNA methyltransferase 11 homolog antikoerper, tRNA methyltransferase 11 homolog L homeolog antikoerper, Trmt11 antikoerper, trmt11.L antikoerper, TRMT11 antikoerper

Hintergrund: TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

Molekulargewicht: 53 kDa (MW of target protein)