PIN4 Antikörper (Middle Region)
-
- Target Alle PIN4 Antikörper anzeigen
- PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIN4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PIN4 antibody was raised against the middle region of PIN4
- Aufreinigung
- Affinity purified
- Immunogen
- PIN4 antibody was raised using the middle region of PIN4 corresponding to a region with amino acids LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
- Top Product
- Discover our top product PIN4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIN4 Blocking Peptide, catalog no. 33R-5002, is also available for use as a blocking control in assays to test for specificity of this PIN4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIN4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))
- Andere Bezeichnung
- PIN4 (PIN4 Produkte)
- Synonyme
- 2410002I22Rik antikoerper, EPVH antikoerper, Par14 antikoerper, PAR14 antikoerper, PAR17 antikoerper, zgc:110008 antikoerper, peptidylprolyl cis/trans isomerase, NIMA-interacting 4 antikoerper, protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) antikoerper, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) antikoerper, PIN4 antikoerper, Pin4 antikoerper, pin4 antikoerper
- Hintergrund
- This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle and chromatin remodeling.
- Molekulargewicht
- 16 kDa (MW of target protein)
-