HIST2H2BF Antikörper (N-Term)

Produktnummer ABIN630669

Produktdetails anti-HIST2H2BF Antikörper

Target: HIST2H2BF (Histone H2B Type 2-F (HIST2H2BF))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HIST2H2BF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HIST2 H2 F antibody was raised against the N terminal of HIST2 2 F

Aufreinigung: Affinity purified

Immunogen: HIST2 H2 F antibody was raised using the N terminal of HIST2 2 F corresponding to a region with amino acids MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HIST2H2BF Blocking Peptide, catalog no. 33R-6272, is also available for use as a blocking control in assays to test for specificity of this HIST2H2BF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIST0 0 F antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HIST2H2BF

Target: HIST2H2BF (Histone H2B Type 2-F (HIST2H2BF))

Andere Bezeichnung: HIST2H2BF (HIST2H2BF Produkte)

Synonyme: histone cluster 2, H2bf antikoerper, histone cluster 2 H2B family member f antikoerper, HIST2H2BF antikoerper

Hintergrund: HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Molekulargewicht: 14 kDa (MW of target protein)