CAD Antikörper (C-Term)

Produktnummer ABIN630658

Produktdetails anti-CAD Antikörper

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CAD antibody was raised against the C terminal of CAD

Aufreinigung: Affinity purified

Immunogen: CAD antibody was raised using the C terminal of CAD corresponding to a region with amino acids ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAD Blocking Peptide, catalog no. 33R-1109, is also available for use as a blocking control in assays to test for specificity of this CAD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAD

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Andere Bezeichnung: CAD (CAD Produkte)

Synonyme: Cpad antikoerper, AU018859 antikoerper, 2410008J01Rik antikoerper, cb456 antikoerper, wu:fc30c12 antikoerper, wu:fc33d01 antikoerper, wu:fc67g02 antikoerper, si:dkey-221h15.3 antikoerper, CAD antikoerper, xcad antikoerper, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase antikoerper, CAD antikoerper, Cad antikoerper, cad antikoerper

Hintergrund: CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.

Molekulargewicht: 243 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process