POLR3F Antikörper (Middle Region)
-
- Target Alle POLR3F Antikörper anzeigen
- POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POLR3F Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- POLR3 F antibody was raised against the middle region of POLR3
- Aufreinigung
- Affinity purified
- Immunogen
- POLR3 F antibody was raised using the middle region of POLR3 corresponding to a region with amino acids LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE
- Top Product
- Discover our top product POLR3F Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POLR3F Blocking Peptide, catalog no. 33R-5238, is also available for use as a blocking control in assays to test for specificity of this POLR3F antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))
- Andere Bezeichnung
- POLR3F (POLR3F Produkte)
- Synonyme
- 2810411G20Rik antikoerper, 3010019O03Rik antikoerper, 3110032A07Rik antikoerper, RPC39 antikoerper, RPC6 antikoerper, zgc:56299 antikoerper, zgc:76983 antikoerper, RNA polymerase III subunit F antikoerper, polymerase (RNA) III (DNA directed) polypeptide F antikoerper, POLR3F antikoerper, Polr3f antikoerper, polr3f antikoerper
- Hintergrund
- POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.
- Molekulargewicht
- 36 kDa (MW of target protein)
-